A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10116
Swiss-prot Accession number	Q91119 (Sequence in FASTA format)
Description	Glycoprotein hormones alpha chain precursor (Gonadotropin alpha chain)(GTH-alpha).
Source organism	Morone saxatilis (Striped bass)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Percoidei;Moronidae; Morone.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit alpha family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Involved in gametogenesis and steroidogenesis
Protein Length	117 Amino acids
Molecular weight	13066
References	1  PubMed abstract 8546811
Domain Name	Hormone_6
Hormone Name	Glycoprotein hormones alpha chain
Mature Hormone Sequence	YPSMDLSNMGCEECTLRKNSVFSRDRPVYQCMGCCFSRAYPTPLKAMKTMTIPKNITSEATCCVAKHSYETEVAGIKVRNHTDCHCSTCYFHKI
Position of mature hormone in Pre-Hormone protein	94 Residues from position (24-117)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10748
Swiss-prot Accession number	P48248 (Sequence in FASTA format)
Description	Somatotropin precursor (Growth hormone).
Source organism	Morone saxatilis (Striped bass)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Percoidei;Moronidae; Morone.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation
Protein Length	204 Amino acids
Molecular weight	23045
References	1  PubMed abstract 7758842
Domain Name	Hormone_1
Hormone Name	Somatotropin
Mature Hormone Sequence	QPITEGQRLFSIAVERVHNLHLLAQRLFTEFESSLQTEEQRQLNKIFLQDFCNSDYIISPIDKHETQRSSVLKLLSISYRLIESWEFPSRSLSVGPAARNQISPKLSELKTGILLLIGANQDGAEMFPDSSTLQLAPYGNYYQSLGADESLRRTYELLACFKKDMHKVETYLTVAKCRLSPEANCTL
Position of mature hormone in Pre-Hormone protein	187 Residues from position (18-204)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	11238
Swiss-prot Accession number	O73811 (Sequence in FASTA format)
Description	Progonadoliberin-2 precursor (Progonadoliberin II) [Contains:Gonadoliberin-2 (Gonadoliberin II) (Luteinizing hormone-releasinghormone II) (LH-RH II) (Gonadotropin-releasing hormone II) (GnRH-II)(Luliberin II); GnRH-associated peptide 2 (GnRH-associated peptideII)].
Source organism	Morone saxatilis (Striped bass)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Percoidei;Moronidae; Morone.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the GnRH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates the secretion of gonadotropins
Protein Length	85 Amino acids
Molecular weight	9673
References	1  PubMed abstract 9845669
Domain Name	N/A
Hormone Name	Gonadoliberin-2
Mature Hormone Sequence	QHWSHGWYPG
Position of mature hormone in Pre-Hormone protein	10 Residues from position (24-33)
Receptor	Q9IA91    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 4

HMRbase accession number	11239
Swiss-prot Accession number	O73812 (Sequence in FASTA format)
Description	Progonadoliberin-1 precursor (Progonadoliberin I) [Contains:Gonadoliberin-1 (Gonadoliberin I) (Luteinizing hormone-releasinghormone I) (LH-RH I) (Gonadotropin-releasing hormone I) (GnRH-I)(Luliberin I); GnRH-associated peptide 1 (GnRH-associated peptide I)].
Source organism	Morone saxatilis (Striped bass)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Percoidei;Moronidae; Morone.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the GnRH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates the secretion of gonadotropins
Protein Length	95 Amino acids
Molecular weight	10411
References	1  PubMed abstract 9845669
Domain Name	N/A
Hormone Name	Gonadoliberin-1
Mature Hormone Sequence	QHWSYGLSPG
Position of mature hormone in Pre-Hormone protein	10 Residues from position (22-32)
Receptor	Q9IA91    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments